PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10040063
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 461aa    MW: 52070.8 Da    PI: 9.7653
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10040063genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53.1e-1859106148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd  l ++vk++G g+W+++ r  g++R++k+c++rw ++l
      Lus10040063  59 KGPWTAEEDAVLMEYVKKHGEGNWNAVQRNSGLNRCGKSCRLRWANHL 106
                      79******************************************9986 PP

2Myb_DNA-binding48.61.8e-15112155146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T++E+ l++++++++G++ W++ a+ ++ gRt++++k++w++
      Lus10040063 112 KGSFTPQEERLIIELHAKMGNK-WARMANLLP-GRTDNEIKNYWNT 155
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.22754110IPR017930Myb domain
SuperFamilySSF466895.24E-3256153IPR009057Homeodomain-like
SMARTSM007172.1E-1558108IPR001005SANT/Myb domain
PfamPF002495.7E-1659106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-2560113IPR009057Homeodomain-like
CDDcd001678.15E-1261106No hitNo description
SMARTSM007174.3E-16111159IPR001005SANT/Myb domain
PROSITE profilePS5129420.085111161IPR017930Myb domain
PfamPF002499.7E-15112155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-25114159IPR009057Homeodomain-like
CDDcd001671.19E-11114155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MISTTNKLGE GGLSGFCTSV GGGGEFNAFI NNNNVAENPQ EKGGKLGINN NGGNRGLKKG  60
PWTAEEDAVL MEYVKKHGEG NWNAVQRNSG LNRCGKSCRL RWANHLRPNL KKGSFTPQEE  120
RLIIELHAKM GNKWARMANL LPGRTDNEIK NYWNTRIKRH QRQGLPLYPP DIQPQQYFQP  180
PPNSYHQFPP VTNSFAFQSE AEEQVSRQDA SSSINVLSLS EYPQHHQHQH NHYSNSTPSP  240
FTFQTQKIDP FSTHVSPLLD YSCSRPTPIL QSANRFKRFA SCGDIANSLV ETNNKHVPHS  300
HHFPSVATAP PLPPHHPIHS PNNNNNNIAH FRNSHHPPQR LYNNNLLLSS RVRSNQFHQE  360
IQKENEEMCS LLATMSRQLP SNHNYGDVTM VHPGQFNTTQ FDKDSKHDEN NNNNNNNNNN  420
MIMRNKDKAH NILLANTITN GGSMYGGLLE DLGRRRMQTR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-32571595106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012070848.11e-89PREDICTED: transcriptional activator Myb
TrEMBLA0A067L3R92e-89A0A067L3R9_JATCU; MYB family protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.21e-65myb domain protein 101